Se rendre au contenu

ELISA Recombinant Rat D-dopachrome decarboxylase(Ddt)

https://research.gentaur.com/web/image/product.template/152175/image_1920?unique=5e1ca23
(0 avis)
Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Cell Biology Uniprot ID:P80254 Gene Names:Ddt Organism:Rattus norvegicus (Rat) AA Sequence:PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL Expression Region:2-118aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:20.4 kDa Alternative Name(s):D-dopachrome tautomerase Relevance:Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Reference:"Cloning and sequencing of a cDNA encoding rat D-dopachrome tautomerase." Zhang M., Aman P., Grubb A., PanagopoµLos I., Hindemith A., Rosengren E., Rorsman H. FEBS Lett. 373:203-206(1995) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days

1.047,70 € 1047.7 EUR 1.047,70 € Hors taxes

1.047,70 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.