ELISA Recombinant Marinomonas sp. Probable intracellular septation protein A (Mmwyl1_3397)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Marinomonas sp. (strain MWYL1) Uniprot NO.:A6W0S1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKILFDFLPIVIFFVVYKMTGNIIIATAILIPATIIQVGFTWFKNRTIEKMHLVSLALVV LLGGATVLLGDGDFIKWKPTIVNGLFAIAFLGSQFIGDKNIIQRMMGDKLDLPFKVWRTL NLAWVGFFIVSGVTNLYVAFSYSEEIWVDFKLFGLLGMTIVFIILQGIYLSSHLQNKE Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:Mmwyl1_3397 Expression Region:1-178 Sequence Info:fµLl length protein