Se rendre au contenu

ELISA Recombinant Aethionema cordifolium Photosystem I assembly protein Ycf4(ycf4)

https://research.gentaur.com/web/image/product.template/115690/image_1920?unique=bf930ac
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Aethionema cordifolium (Lebanon stonecress) Uniprot NO.:A4QJC6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSWRSESIWIELRTGSRKTSNFFWAFILFLGSLGFLLVGTSSYLGRNVISLFPSQQIIFF PQGIVMSFYGIAGLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIFLRF LMKDIQSIRIEVKEGISARRVLYMEIRGQGAIPLIRTDENFTTREIEQKAAELAYFLRVP IEVF Protein Names:Recommended name: Photosystem I assembly protein Ycf4 Gene Names:Name:ycf4 Expression Region:1-184 Sequence Info:fµLl length protein

1.529,00 € 1529.0 EUR 1.529,00 € Hors taxes

1.529,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.