Se rendre au contenu

ELISA Recombinant Natural cytotoxicity triggering receptor 3(NCR3)

https://research.gentaur.com/web/image/product.template/135756/image_1920?unique=45d657d
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O14931 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG Protein Names:Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Activating natural killer receptor p30 Natural killer cell p30-related protein Short name= NK-p30 Short name= NKp30 CD_antigen= CD337 Gene Names:Name:NCR3 Synonyms:1C7, LY117 Expression Region:19-201 Sequence Info:fµLl length protein

1.528,00 € 1528.0 EUR 1.528,00 € Hors taxes

1.528,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.