Se rendre au contenu

ELISA Recombinant Dekkera bruxellensis Cytochrome c oxidase subunit 2(COX2)

https://research.gentaur.com/web/image/product.template/123891/image_1920?unique=9fe42c5
(0 avis)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dekkera bruxellensis (Brettanomyces custersii) Uniprot NO.:P43374 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYmLNNmLNDVPTPWGMFFQDSATPNMEGMMELHNNVMFYLCMmLGFVSYmLYNmLTTYN HSVLPYKYLYHGQFIEIVWTTFPAMILLIIAFPSFILLYICDEVIAPAMTIKAMGLQWYW KYEYSDFIDDKGETIEFESYMIPEDLLEEGQLRQLDVDSPIVCPVDTHMRFIVTAADVIH DFAMPSLGIKIDAVPGRLNQTSALIQREGVYYGQCSELCGVMHSSMPIKIEAVSLGEFLA WIDEQ Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II Gene Names:Name:COX2 Expression Region:1-245 Sequence Info:fµLl length protein

1.594,00 € 1594.0 EUR 1.594,00 € Hors taxes

1.594,00 € Hors taxes

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.