ELISA Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P60266 Gene Names: N/A Organism: Centruroides suffusus suffusus (Mexican scorpion) AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN Expression Region: 1-66aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 9.6 kDa Alternative Name(s): Css IV Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals. Reference: "Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusu.Martin M.-F., Garcia Y., Perez L.G., el Ayeb M., Kopeyan C., Bechis G., Jover E., Rochat H.J. Biol. Chem. 262:4452-4459(1987) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.