ELISA Recombinant Dolichol-phosphate mannosyltransferase subunit 3(DPM3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9P2X0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLARRGLRF Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase subunit 3 Alternative name(s): DPM synthase complex subunit 3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Mannose-P-doli Gene Names:Name:DPM3 Expression Region:1-92 Sequence Info:fµLl length protein