ELISA Recombinant Bacillus halodurans Spore morphogenesis and germination protein ywcE(ywcE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Uniprot NO.:Q9KB63
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLFFAYmLVASATPLFLWLEHRKIALTSIPFIIIMWVLALSHMFEGFLFDLHHSVFLTA FFVNVIIAHFAALVLYAYPHIRPKSRTFTESMD
Protein Names:Recommended name: Spore morphogenesis and germination protein ywcE
Gene Names:Name:ywcE Ordered Locus Names:BH2068
Expression Region:1-93
Sequence Info:fµLl length protein
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.