ELISA Recombinant Bacillus halodurans Spore morphogenesis and germination protein ywcE(ywcE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) Uniprot NO.:Q9KB63 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLFFAYmLVASATPLFLWLEHRKIALTSIPFIIIMWVLALSHMFEGFLFDLHHSVFLTA FFVNVIIAHFAALVLYAYPHIRPKSRTFTESMD Protein Names:Recommended name: Spore morphogenesis and germination protein ywcE Gene Names:Name:ywcE Ordered Locus Names:BH2068 Expression Region:1-93 Sequence Info:fµLl length protein