ELISA Recombinant Azotobacter vinelandii Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Azotobacter vinelandii (strain DJ / ATCC BAA-1303) Uniprot NO.:C1DKY9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIGVTLAVAVGGALGCLLRFATSNWISAHWPQHFYAATLAVNIAGCLLIGYLYGQFLLRP EVPLALRAGLIAGFLGGLTTFSSFSLDTLRLLESGQAPLAFSYLAFSVLGGLLATWAGLI LTKL Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:Avin_28190 Expression Region:1-124 Sequence Info:fµLl length protein