Skip to Content

ELISA Recombinant Enterobacteria phage IKe Gene 1 protein(I)

https://research.gentaur.com/web/image/product.template/125369/image_1920?unique=9fe42c5
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Enterobacteria phage IKe (Bacteriophage IKe) Uniprot NO.:P03658 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVYVVTGKLGAGKTLVAVSRIQRTLAKGGIVATNLNLKLHHFPQVGRYAKQCRVMRIAD KPTLEDLESIGRGNLTYDESKNGLLVLDECGTWFNSRNWSDKSRQPVIDWCLHARKLGWD IIFIIQDISLMDKQARDALAEHVVYCRRLDKLNIPIIGGLISVLSGGRLPLPKVHFGIVK YGDNPQSLTVDKWVYTGTDLYAAYDTKQIFTSDREISPPYCPLSPYYTHGIFSVKRDAKY YMRMTKIYFKKMNRVFLMASFLALGAACGIFYKSQAYSNQLQHIQDNSKTSVISKTDQSA EILPRLSINSYSQMGYDVSVTFKDAKAKIYNSFDLIKDGYRVDIKDACHVTIVKKSYIQQ ITCEG Protein Names:Recommended name: Gene 1 protein Alternative name(s): G1P Gene Names:Name:I Expression Region:1-365 Sequence Info:fµLl length protein

1,720.00 € 1720.0 EUR 1,720.00 € Tax Excluded

1,720.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.