ELISA Recombinant Mouse Triggering receptor expressed on myeloid cells 2(Trem2),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: Q99NH8
Gene Names: Trem2
Organism: Mus muscµLus (Mouse)
AA Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS
Expression Region: 19-171aa
Sequence Info: ExtracellµLar Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 20.8 kDa
Alternative Name(s): Short name: TREM-2 Alternative name(s): Triggering receptor expressed on monocytes 2
Relevance: May have a role in chronic inflammations and may stimµLate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
Reference: "Cloning and characterization of a novel mouse myeloid DAP12-associated receptor family."Daws M.R., Lanier L.L., Seaman W.E., Ryan J.C. Eur. J. Immunol. 31:783-791(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.