Se rendre au contenu

ELISA Recombinant Mouse G protein-activated inward rectifier potassium channel 4(Kcnj5)

https://research.gentaur.com/web/image/product.template/144567/image_1920?unique=2109108
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:P48545 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLTEGKKPRQRYMEKTGKC NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYVRGDLDH VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFE VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP SCCAKELAEMKRSGRLLQYLPSPPLLGGCAEAGNEAEAEKDEEGEPNGLSVSQATRGSM Protein Names:Recommended name: G protein-activated inward rectifier potassium channel 4 Short name= GIRK-4 Alternative name(s): Cardiac inward rectifier Short name= CIR Heart KATP channel Inward rectifier K(+) channel Kir3.4 KATP-1 Gene Names:Name:Kcnj5 Synonyms:Girk4 Expression Region:1-419 Sequence Info:FµLl length protein

1.777,00 € 1777.0 EUR 1.777,00 €

1.777,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.