ELISA Recombinant Elongation of very long chain fatty acids protein 1(ELOVL1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BW60 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRG FMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFI ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYL YYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYG TIFFmLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN Protein Names:Recommended name: Elongation of very long chain fatty acids protein 1 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase ELOVL1 ELOVL fatty acid elongase 1 Short name= ELOVL FA elongase 1 Gene Names:Name:ELOVL1 Synonyms:SSC1 ORF Names:CGI-88 Expression Region:1-279 Sequence Info:fµLl length protein