Skip to Content

ELISA Recombinant Sphingosine 1-phosphate receptor 5(S1PR5)

https://research.gentaur.com/web/image/product.template/139056/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9H228 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD Protein Names:Recommended name: Sphingosine 1-phosphate receptor 5 Short name= S1P receptor 5 Short name= S1P5 Alternative name(s): Endothelial differentiation G-protein-coupled receptor 8 Sphingosine 1-phosphate receptor Edg-8 Short name= Gene Names:Name:S1PR5 Synonyms:EDG8 Expression Region:1-398 Sequence Info:fµLl length protein

1,755.00 € 1755.0 EUR 1,755.00 €

1,755.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.