Skip to Content

ELISA Recombinant Abhydrolase domain-containing protein 3(ABHD3)

https://research.gentaur.com/web/image/product.template/129321/image_1920?unique=e52fe4f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8WU67 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQRLAMDLRmLSRELSLYLEHQVRVGFFGSGVGLSLILGFSVAYAFYYLSSIAKKPQLVT GGESFSRFLQDHCPVVTETYYPTVWCWEGRGQTLLRPFITSKPPVQYRNELIKTADGGQI SLDWFDNDNSTCYMDASTRPTILLLPGLTGTSKESYILHMIHLSEELGYRCVVFNNRGVA GENLLTPRTYCCANTEDLETVIHHVHSLYPSAPFLAAGVSMGGmLLLNYLGKIGSKTPLM AAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVNKHRHMFVKQVDMDHVMKAKS IREFDKRFTSVMFGYQTIDDYYTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAK QNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMVEHGHELS Protein Names:Recommended name: Abhydrolase domain-containing protein 3 EC= 3.1.1.- Alternative name(s): Lung alpha/beta hydrolase 3 Gene Names:Name:ABHD3 Synonyms:LABH3 Expression Region:1-409 Sequence Info:fµLl length protein

1,767.00 € 1767.0 EUR 1,767.00 €

1,767.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.