ELISA Recombinant Picrophilus torridus Protease HtpX homolog(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) Uniprot NO.:Q6L2Q7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLYSIKLKVITILAGIGIALLFSLIAYGLLYYFYGLSGISIIYFLLIFVLFIDIIQWLV SPYIIGMTYRLQKVSPMSQYGYLIDIVHDAAEKNNIKEPEVYIAMRGSPNAFAYSSPLAG KRIAFTKSILDILNRDELEAVAGHELGHLKHHDVELLLAIGLIPTLIFYLGYSMIFSGFG RRNGGSFFLVAIILFILSSVFNIMILGVNRIRESYADVNSAMTIPNGAENLQNALAKIYS YSMPSKQTSNSTVNmLMFSDHIENDLGRDYRKLVEKWKNMKPPVSIFSDHPHPAKRIQIL ERYKNSF Protein Names:Recommended name: Protease HtpX homolog EC= 3.4.24.- Gene Names:Name:htpX Ordered Locus Names:PTO0160 Expression Region:1-307 Sequence Info:fµLl length protein