ELISA Recombinant Inner membrane protein yohK(yohK)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella flexneri Uniprot NO.:P0AD20 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMANIWWSLPLTLIVFFAARKLAARYKFPLLNPLLVAMVVIIPFLmLTGISYDSYFKGSE VLNDLLQPAVVALAYPLYEQLHQIRARWKSIITICFIGSVVAMVTGTSVALLMGASPEIA ASILPKSVTTPIAMAVGGSIGGIPAISAVCVIFVGILGAVFGHTLLNAMRIRTKAARGLA MGTASHALGTARCAELDYQEGAFSSLALVLCGIITSLIAPFLFPIILAVMG Protein Names:Recommended name: Inner membrane protein yohK Gene Names:Name:yohK Ordered Locus Names:SF2227, S2356 Expression Region:1-231 Sequence Info:fµLl length protein