ELISA Recombinant CKLF-like MARVEL transmembrane domain-containing protein 5(CMTM5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96DZ9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM AAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPW PGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAV TSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 5 Alternative name(s): Chemokine-like factor superfamily member 5 Gene Names:Name:CMTM5 Synonyms:CKLFSF5 Expression Region:1-223 Sequence Info:fµLl length protein