ELISA Recombinant Hydroxycarboxylic acid receptor 1(HCAR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BXC0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVA DFLLMICLPFRTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHP HHAVNTISTRVAAGIVCTLWALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIM FQLEFFMPLGIILFCSFKIVWSLRRRQQLARQARMKKATRFIMVVAIVFITCYLPSVSAR LYFLWTVPSSACDPSVHGALHITLSFTYMNSmLDPLVYYFSSPSFPKFYNKLKICSLKPK QPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH Protein Names:Recommended name: Hydroxycarboxylic acid receptor 1 Alternative name(s): G-protein coupled receptor 104 G-protein coupled receptor 81 Gene Names:Name:HCAR1 Synonyms:GPR104, GPR81, HCA1 ORF Names:FKSG80 Expression Region:1-346 Sequence Info:fµLl length protein